PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03990.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 157aa    MW: 18232.9 Da    PI: 10.3018
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03990.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.51.8e-51181431128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lp+GfrFhP+d+elv++yL ++  ++  +   v+ evd++++ePwd+p++++ + kewyf+s++d+kyatg+r+nrat++gyWkat
  Rsa1.0_03990.1_g00005.1  18 LPRGFRFHPRDDELVCDYLMRRNVRSLYQP-VVLIEVDLNQCEPWDIPQTARVGGKEWYFYSQKDRKYATGQRTNRATATGYWKAT 102
                              799****************99866666555.4899*************9889999******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              gkd+++ + +g+lvg++ktLvfy+grapkg+ktdWvmhe+rl
  Rsa1.0_03990.1_g00005.1 103 GKDRAIQR-NGSLVGMRKTLVFYRGRAPKGHKTDWVMHEFRL 143
                              ******99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.45E-5410149IPR003441NAC domain
PROSITE profilePS5100549.30418157IPR003441NAC domain
PfamPF023658.1E-2619143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MDAGEENKGS ISMVEAKLPR GFRFHPRDDE LVCDYLMRRN VRSLYQPVVL IEVDLNQCEP  60
WDIPQTARVG GKEWYFYSQK DRKYATGQRT NRATATGYWK ATGKDRAIQR NGSLVGMRKT  120
LVFYRGRAPK GHKTDWVMHE FRLQGTSIHH SPKVMIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-471414311140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0266459e-82AB026645.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGH6.
GenBankCP0026869e-82CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013749895.11e-105PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE69e-83NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A078J9141e-105A0A078J914_BRANA; BnaA05g26240D protein
STRINGBra034713.1-P1e-105(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36192859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12977.11e-103NAC family protein